PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G02310.1
Common NameAGL4, F14P3.4, SEP2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 250aa    MW: 28577.5 Da    PI: 8.5487
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G02310.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.82.2e-31959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaev++i+fs++gklye++s
  AT3G02310.1  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCS 59
                 79***********************************************96 PP

2K-box93.43.9e-3178173499
        K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                   + +++ +++ e++++e+ kLk ++enLqr+qR+llGedL++L+ keL+qLe+qL+ slk++R  K++++l+q+++lq ke+ l ++n+aL++kle
  AT3G02310.1  78 IEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLDANRALSMKLE 173
                  56667788999**********************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.319161IPR002100Transcription factor, MADS-box
SMARTSM004324.2E-41160IPR002100Transcription factor, MADS-box
CDDcd002657.93E-45277No hitNo description
SuperFamilySSF554551.11E-33280IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003199.9E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-323859IPR002100Transcription factor, MADS-box
PfamPF014869.0E-2585172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.3988178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0030154Biological Processcell differentiation
GO:0048481Biological Processplant ovule development
GO:0071486Biological Processcellular response to high light intensity
GO:0071492Biological Processcellular response to UV-A
GO:0005634Cellular Componentnucleus
GO:0009523Cellular Componentphotosystem II
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007602developmental stagefloral organ primordium development stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVSLIVFSN RGKLYEFCST  60
SNMLKTLERY QKCSYGSIEV NNKPAKELEN SYREYLKLKG RYENLQRQQR NLLGEDLGPL  120
NSKELEQLER QLDGSLKQVR CIKTQYMLDQ LSDLQGKEHI LLDANRALSM KLEDMIGVRH  180
HHIGGGWEGG DQQNIAYGHP QAHSQGLYQS LECDPTLQIG YSHPVCSEQM AVTVQGQSQQ  240
GNGYIPGWML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_D4e-33751741103Developmental protein SEPALLATA 3
4ox0_C4e-33751741103Developmental protein SEPALLATA 3
4ox0_B4e-33751741103Developmental protein SEPALLATA 3
4ox0_A4e-33751741103Developmental protein SEPALLATA 3
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.411550.0flower| inflorescence| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425634300.0
Genevisible259124_at0.0
Expression AtlasAT3G02310-
AtGenExpressAT3G02310-
ATTED-IIAT3G02310-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed early during flower development.
Functional Description ? help Back to Top
Source Description
TAIRMADS-box protein, binds K domain of AG in vivo
UniProtProbable transcription factor. Functions with SEPALLATA1/AGL2 and SEPALLATA3/AGL9 to ensure proper development of petals, stamens and carpels and to prevent the indeterminate growth of the flower meristem. Forms a heterodimer via the K-box domain with AG, that could be involved in genes regulation during floral meristem development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G02310.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction -- BIND ? help Back to Top
Source Intact With Description
BINDAT4G18960AG interacts with AGL4.
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G02310, AT3G57230, AT4G18960, AT4G37940, AT5G23260
IntActSearch P29384
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Triple mutations in the SEP1, SEP2 and SEP3 genes result in the replacement of the stamens and petals by sepals and of the carpels by a new mutant flower with sepaloid organs. {ECO:0000269|PubMed:9418042}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G02310
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATHAGL4A0.0M55552.1 Arabidopsis thaliana transcription factor (AGL4) mRNA, complete cds.
GenBankBT0204780.0BT020478.1 Arabidopsis thaliana At3g02310 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_186880.10.0developmental protein SEPALLATA 2
SwissprotP293840.0SEP2_ARATH; Developmental protein SEPALLATA 2
TrEMBLQ5XXL40.0Q5XXL4_ARATH; At3g02310
STRINGAT3G02310.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32892765
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Sung SK,Yu GH,Nam J,Jeong DH,An G
    Developmentally regulated expression of two MADS-box genes, MdMADS3 and MdMADS4, in the morphogenesis of flower buds and fruits in apple.
    Planta, 2000. 210(4): p. 519-28
    [PMID:10787044]
  2. Pelaz S,Ditta GS,Baumann E,Wisman E,Yanofsky MF
    B and C floral organ identity functions require SEPALLATA MADS-box genes.
    Nature, 2000. 405(6783): p. 200-3
    [PMID:10821278]
  3. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  4. Pelaz S,Gustafson-Brown C,Kohalmi SE,Crosby WL,Yanofsky MF
    APETALA1 and SEPALLATA3 interact to promote flower development.
    Plant J., 2001. 26(4): p. 385-94
    [PMID:11439126]
  5. Li J,Jia D,Chen X
    HUA1, a regulator of stamen and carpel identities in Arabidopsis, codes for a nuclear RNA binding protein.
    Plant Cell, 2001. 13(10): p. 2269-81
    [PMID:11595801]
  6. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  7. Favaro R, et al.
    MADS-box protein complexes control carpel and ovule development in Arabidopsis.
    Plant Cell, 2003. 15(11): p. 2603-11
    [PMID:14555696]
  8. Moore RC,Grant SR,Purugganan MD
    Molecular population genetics of redundant floral-regulatory genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2005. 22(1): p. 91-103
    [PMID:15371526]
  9. Ditta G,Pinyopich A,Robles P,Pelaz S,Yanofsky MF
    The SEP4 gene of Arabidopsis thaliana functions in floral organ and meristem identity.
    Curr. Biol., 2004. 14(21): p. 1935-40
    [PMID:15530395]
  10. Yang Y,Jack T
    Defining subdomains of the K domain important for protein-protein interactions of plant MADS proteins.
    Plant Mol. Biol., 2004. 55(1): p. 45-59
    [PMID:15604664]
  11. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  12. Kaufmann K,Anfang N,Saedler H,Theissen G
    Mutant analysis, protein-protein interactions and subcellular localization of the Arabidopsis B sister (ABS) protein.
    Mol. Genet. Genomics, 2005. 274(2): p. 103-18
    [PMID:16080001]
  13. Malcomber ST,Kellogg EA
    SEPALLATA gene diversification: brave new whorls.
    Trends Plant Sci., 2005. 10(9): p. 427-35
    [PMID:16099195]
  14. Ma H,Yanofsky MF,Meyerowitz EM
    AGL1-AGL6, an Arabidopsis gene family with similarity to floral homeotic and transcription factor genes.
    Genes Dev., 1991. 5(3): p. 484-95
    [PMID:1672119]
  15. Matias-Hernandez L, et al.
    VERDANDI is a direct target of the MADS domain ovule identity complex and affects embryo sac differentiation in Arabidopsis.
    Plant Cell, 2010. 22(6): p. 1702-15
    [PMID:20581305]
  16. Jetha K,Thei
    Arabidopsis SEPALLATA proteins differ in cooperative DNA-binding during the formation of floral quartet-like complexes.
    Nucleic Acids Res., 2014. 42(17): p. 10927-42
    [PMID:25183521]
  17. Savidge B,Rounsley SD,Yanofsky MF
    Temporal relationship between the transcription of two Arabidopsis MADS box genes and the floral organ identity genes.
    Plant Cell, 1995. 7(6): p. 721-33
    [PMID:7647563]
  18. Tandre K,Albert VA,Sund
    Conifer homologues to genes that control floral development in angiosperms.
    Plant Mol. Biol., 1995. 27(1): p. 69-78
    [PMID:7865797]
  19. Greco R, et al.
    MADS box genes expressed in developing inflorescences of rice and sorghum.
    Mol. Gen. Genet., 1997. 253(5): p. 615-23
    [PMID:9065695]
  20. Fan HY,Hu Y,Tudor M,Ma H
    Specific interactions between the K domains of AG and AGLs, members of the MADS domain family of DNA binding proteins.
    Plant J., 1997. 12(5): p. 999-1010
    [PMID:9418042]